Did you know that you can buy products from over 140 different suppliers from us?

Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1) (N-Term) antibody

Details for Product No. ABIN503271
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 8430401B01, AI450757, AI462342, SRrp508, SRrp86, Sfrs12, Srsf12, SFRS12, Srrp86
Epitope
N-Term
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Zebrafish (Danio rerio), Cow (Bovine), Human
(9)
Host
Rabbit
(7), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (5), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503271
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SFRS12
Sequence DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSL LAPAPTMTSL
Predicted Reactivity Human :100 %,   Zebrafish :90 %,   Bovine :90 %,   Green puffer :90 %,   Mouse :90 %,   Atlantic salmon :80 %,  
Characteristics This is a rabbit polyclonal antibody against SFRS12. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SFRS12
Background SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins (Barnard et al., 2002 [PubMed 11991645]).
Molecular Weight 72 kDa
Gene ID 140890
NCBI Accession NM_001077199, NP_001070667
UniProt Q8WXA9-2
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 624 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1) (N-Term) antibody WB Suggested Anti-SFRS12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HT1080 cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (7), (3)
Reactivities (9)
Applications (7), (5), (2), (1), (1)
Epitopes (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503271
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top