Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503271

Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 8430401B01, AI450757, AI462342, SRrp508, SRrp86, Sfrs12, Srsf12, SFRS12, Srrp86
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Zebrafish (Danio rerio), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503271
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SFRS12 antibody: synthetic peptide directed towards the N terminal of human SFRS12
Sequence DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSL LAPAPTMTSL
Predicted Reactivity Human :100%,   Zebrafish :92%,   Bovine :92%,   Green puffer :92%,   Mouse :92%,   Atlantic salmon :84%,  
Characteristics This is a rabbit polyclonal antibody against SFRS12. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SFRS12
Background SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins (Barnard et al., 2002 [PubMed 11991645]).
Molecular Weight 72kDa
Gene ID 140890
NCBI Accession NP_001070667, NM_001077199
UniProt Q8WXA9-2
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SFRS12 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1)", type "Antibodies"
Hosts (7), (3)
Reactivities (9)
Applications (7), (5), (2), (1), (1)
Epitopes (2), (1), (1), (1)
Beacon