Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503277

Solute Carrier Family 47, Member 2 (SLC47A2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MATE2, MATE2-B, MATE2-K, MATE2K, 4933429E10Rik, SLC47A2, RGD1562382, DKFZp469G161
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503277
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC47A2 antibody: synthetic peptide directed towards the C terminal of human SLC47A2
Sequence TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAA LGAASATLMV
Predicted Reactivity Dog : 84%, Horse : 78%
Characteristics This is a rabbit polyclonal antibody against SLC47A2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SLC47A2
Background SLC47A2 is a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance.This gene encodes a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance. This gene is one of two members of the MATE transporter family located near each other on chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Molecular Weight 61kDa
Gene ID 146802
NCBI Accession NP_001093116, NM_001099646
UniProt Q86VL8-3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC47A2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Tanihara, Masuda, Sato et al.: "Substrate specificity of MATE1 and MATE2-K, human multidrug and toxin extrusions/H(+)-organic cation antiporters." in: Biochemical pharmacology, Vol. 74, Issue 2, pp. 359-71, 2007 (PubMed).

Alternatives for antigen "Solute Carrier Family 47, Member 2 (SLC47A2)", type "Antibodies"
Hosts (6), (4)
Reactivities (9), (1)
Applications (10), (7), (1)
Epitopes (6), (4), (1), (1)
Beacon