Did you know that you can buy products from over 140 different suppliers from us?

Solute Carrier Family 47, Member 2 (SLC47A2) (C-Term) antibody

Details for Product No. ABIN503277
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MATE2, MATE2-B, MATE2-K, MATE2K, 4933429E10Rik, SLC47A2, RGD1562382, DKFZp469G161
Epitope
C-Term
(7), (6), (6), (5)
Reactivity
Dog (Canine), Human
(15)
Host
Rabbit
(9), (6), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (12), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503277
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human SLC47A2
Sequence TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAA LGAASATLMV
Predicted Reactivity Dog : 84 %, Horse : 74 %
Characteristics This is a rabbit polyclonal antibody against SLC47A2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SLC47A2
Background SLC47A2 is a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance.This gene encodes a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance. This gene is one of two members of the MATE transporter family located near each other on chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Molecular Weight 61 kDa
Gene ID 146802
NCBI Accession NM_001099646, NP_001093116
UniProt Q86VL8-3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 566 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Solute Carrier Family 47, Member 2 (SLC47A2) (C-Term) antibody WB Suggested Anti-SLC47A2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Human Lung
Product cited in: Tanihara, Masuda, Sato et al.: "Substrate specificity of MATE1 and MATE2-K, human multidrug and toxin extrusions/H(+)-organic cation antiporters." in: Biochemical pharmacology, Vol. 74, Issue 2, pp. 359-71, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503277
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top