Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503286

Dihydropyrimidinase-Like 3 (DPYSL3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CRMP-4, CRMP4, DRP-3, DRP3, LCRMP, ULIP, ULIP-1, Crmp4, TUC-4b, CRMP4A, CRMP4B, TUC4, Ulip, Ulip1, crmp4, dpysl3, drp-3, drp3, lcrmp, nsp1, tuc-4, tuc4, ulip, ulip-1, MGC69487, dpysl3-b, xCRMP4, DRP-3 ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN503286
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DPYSL3 antibody: synthetic peptide directed towards the middle region of human DPYSL3
Sequence VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSG TQVDEGVRSA
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Horse : 92%, Rabbit : 92%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against DPYSL3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DPYSL3
Background DPYSL3 is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. DPYSL3 plays a role in axon guidance, neuronal growth cone collapse and cell migration.
Molecular Weight 62kDa
Gene ID 1809
NCBI Accession NP_001378, NM_001387
UniProt Q14195
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DPYSL3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "Dihydropyrimidinase-Like 3 (DPYSL3)", type "Antibodies"
Hosts (43), (7)
Reactivities (49), (24), (24), (20), (20), (8), (1), (1)
Applications (36), (21), (16), (12), (11), (4), (3), (1), (1), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Epitopes (9), (2), (2), (2), (1), (1), (1), (1)
Beacon