Dihydropyrimidinase-Like 3 (DPYSL3) (Middle Region) antibody

Details for Product No. ABIN503286
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CRMP-4, CRMP4, DRP-3, DRP3, LCRMP, ULIP, ULIP-1, Crmp4, TUC-4b, CRMP4A, CRMP4B, TUC4, Ulip, Ulip1, crmp4, dpysl3, drp-3, drp3, lcrmp, nsp1, tuc-4, tuc4, ulip, ulip-1, MGC69487, dpysl3-b, xCRMP4, DRP-3 ... show more
CRMP-4, CRMP4, DRP-3, DRP3, LCRMP, ULIP, ULIP-1, Crmp4, TUC-4b, CRMP4A, CRMP4B, TUC4, Ulip, Ulip1, crmp4, dpysl3, drp-3, drp3, lcrmp, nsp1, tuc-4, tuc4, ulip, ulip-1, MGC69487, dpysl3-b, xCRMP4, DRP-3-B, DPYSL3 show less
Epitope
Middle Region
(8), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Chicken
(44), (19), (18), (12), (12), (1), (1)
Host
Rabbit
(38), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(37), (21), (13), (10), (9), (5), (4), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN503286
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human DPYSL3
Sequence VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSG TQVDEGVRSA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Horse : 90 %, Rabbit : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against DPYSL3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DPYSL3
Background DPYSL3 is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. DPYSL3 plays a role in axon guidance, neuronal growth cone collapse and cell migration.
Molecular Weight 62 kDa
Gene ID 1809
NCBI Accession NM_001387, NP_001378
UniProt Q14195
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 570 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Dihydropyrimidinase-Like 3 (DPYSL3) (Middle Region) antibody WB Suggested Anti-DPYSL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T
anti-Dihydropyrimidinase-Like 3 (DPYSL3) (Middle Region) antibody (2) Immunohistochemistry with Small intestine, submucosal plexus tissue at an antibody concentration of 10µg/ml using anti-DPYSL3 antibody (ARP51962_P050)
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Hosts (38), (8)
Reactivities (44), (19), (18), (12), (12), (1), (1)
Applications (37), (21), (13), (10), (9), (5), (4), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (2), (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top