Did you know that you can buy products from over 140 different suppliers from us?

Lysophospholipase I (LYPLA1) (Middle Region) antibody

Details for Product No. ABIN503315
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms zgc:110260, Pla1a, APT-1, APT1, LPL-I, LPL1, hAPT1, 25KDL
Epitope
Middle Region
(13), (7), (3), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human
(31), (15), (14)
Host
Rabbit
(30), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(33), (23), (6), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503315
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human LYPLA1
Sequence SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPS NRIILGGFSQ
Predicted Reactivity African clawed frog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Dog : 90 %, Zebrafish : 90 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against LYPLA1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LYPLA1
Background Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.
Molecular Weight 25 kDa
Gene ID 10434
NCBI Accession NM_006330, NP_006321
UniProt O75608
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 230 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Lysophospholipase I (LYPLA1) (Middle Region) antibody WB Suggested Anti-LYPLA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: CCRF-CEM cell lysate
Background publications Devedjiev, Dauter, Kuznetsov et al.: "Crystal structure of the human acyl protein thioesterase I from a single X-ray data set to 1.5 A." in: Structure (London, England : 1993), Vol. 8, Issue 11, pp. 1137-46, 2000 (PubMed).

Validation Images
back to top