Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503368

Spermatogenesis Associated 17 (SPATA17) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms IQCH, MSRG11, MSRG-11, RP11-144C20.1, 1700065F16Rik, 4930504I07Rik, 4930513F16Rik
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503368
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SPATA17 antibody: synthetic peptide directed towards the C terminal of human SPATA17
Sequence NMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRSENPK KWICDKDFQT
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against SPATA17. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SPATA17
Background SPATA17 contains 3 IQ domains. The function of the SPATA17 protein is not known.
Molecular Weight 43kDa
Gene ID 128153
NCBI Accession NP_620151, NM_138796
UniProt Q96L03
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SPATA17 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "Spermatogenesis Associated 17 (SPATA17)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2), (1)
Epitopes (1)
Beacon