Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503372

Leucine Rich Repeat Containing 28 (LRRC28) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1300004K21Rik, 2210012C09Rik, 2310058O11Rik, MGC69360
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503372
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LRRC28 antibody: synthetic peptide directed towards the C terminal of human LRRC28
Sequence KDLNFLSPISLPRSLLELLHCPLGHCHRCSEPMFTIVYPK LFPLRETPMA
Predicted Reactivity Human : 100%, Mouse : 100%, Dog : 92%, Pig : 92%, Rabbit : 92%, Rat : 92%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against LRRC28. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LRRC28
Background LRRC28 contains 11 LRR (leucine-rich) repeats. The function of the LRRC28 protein is not known.
Molecular Weight 42kDa
Gene ID 123355
NCBI Accession NP_653199, NM_144598
UniProt Q86X40
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LRRC28 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Leucine Rich Repeat Containing 28 (LRRC28)", type "Antibodies"
Hosts (9)
Reactivities (7), (5), (1), (1), (1), (1)
Applications (9), (3), (3), (2)
Epitopes (5), (2), (2), (2)
Beacon