Did you know that you can buy products from over 140 different suppliers from us?

Leucine Rich Repeat Containing 28 (LRRC28) (C-Term) antibody

Details for Product No. ABIN503372
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MGC69360, 1300004K21Rik, 2210012C09Rik, 2310058O11Rik
Epitope
C-Term
(10), (8), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
(14), (4), (1), (1), (1), (1)
Host
Rabbit
(16)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (9), (8), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503372
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human LRRC28
Sequence KDLNFLSPISLPRSLLELLHCPLGHCHRCSEPMFTIVYPK LFPLRETPMA
Predicted Reactivity Human : 100 %, Mouse : 100 %, Dog : 90 %, Pig : 90 %, Rabbit : 90 %, Rat : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against LRRC28. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LRRC28
Background LRRC28 contains 11 LRR (leucine-rich) repeats. The function of the LRRC28 protein is not known.
Molecular Weight 42 kDa
Gene ID 123355
NCBI Accession NM_144598, NP_653199
UniProt Q86X40
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 367 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Leucine Rich Repeat Containing 28 (LRRC28) (C-Term) antibody WB Suggested Anti-LRRC28 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Validation Images
back to top