Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503376

Homeodomain Interacting Protein Kinase 4 (HIPK4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gm162
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503376
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HIPK4 antibody: synthetic peptide directed towards the middle region of human HIPK4
Sequence AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQ EAGHGLWGET
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against HIPK4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HIPK4
Background HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors.
Molecular Weight 69kDa
Gene ID 147746
NCBI Accession NP_653286, NM_144685
UniProt Q8NE63
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Transcription Factors, Apoptosis/Necrosis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HIPK4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Arai, Matsushita, Du et al.: "Novel homeodomain-interacting protein kinase family member, HIPK4, phosphorylates human p53 at serine 9." in: FEBS letters, Vol. 581, Issue 29, pp. 5649-57, 2007 (PubMed).

Alternatives for antigen "Homeodomain Interacting Protein Kinase 4 (HIPK4)", type "Antibodies"
Hosts (18), (9)
Reactivities (25), (8), (5)
Applications (26), (11), (10), (8), (4), (3), (1), (1)
Epitopes (4), (3), (2), (1), (1), (1)
Beacon