Did you know that you can buy products from over 140 different suppliers from us?

Spindle and Centriole Associated Protein 1 (SPICE1) (Middle Region) antibody

Details for Product No. ABIN503379
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CCDC52, ccdc52, zgc:101558, SPICE, Ccdc52, D16Ertd480e, RGD1310729
Epitope
Middle Region
(2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(7), (1), (1), (1), (1), (1)
Host
Rabbit
(9)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503379
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CCDC52
Sequence KEQNWEEKTLPIDTDIQNSSEENRLFTQRWRVSHMGEDLE NKTQAPFVNL
Predicted Reactivity Mouse :100 %,   Human :100 %,   Rat :90 %,   Sumatran orangutan :90 %,   Bovine :70 %,   Dog :70 %,  
Characteristics This is a rabbit polyclonal antibody against CCDC52. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CCDC52
Background The specific function of CCDC52 is not yet known.
Molecular Weight 96 kDa
Gene ID 152185
NCBI Accession NM_144718, NP_653319
UniProt Q8N0Z3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 855 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Spindle and Centriole Associated Protein 1 (SPICE1) (Middle Region) antibody WB Suggested Anti-CCDC52 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
anti-Spindle and Centriole Associated Protein 1 (SPICE1) (Middle Region) antibody (2) Host: Rabbit
Target Name: SPICE1
Sample Tissue: Human Fetal Muscle
Antibody Dilution: 1.0 µg/mL
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Validation Images
back to top