Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503379

Spindle and Centriole Associated Protein 1 (SPICE1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CCDC52, SPICE, Ccdc52, D16Ertd480e, RGD1310729, ccdc52, zgc:101558
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503379
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCDC52 antibody: synthetic peptide directed towards the middle region of human CCDC52
Sequence KEQNWEEKTLPIDTDIQNSSEENRLFTQRWRVSHMGEDLE NKTQAPFVNL
Predicted Reactivity Mouse :100%,   Human :100%,   Rat :92%,   Sumatran orangutan :92%,   Bovine :78%,   Dog :78%,  
Characteristics This is a rabbit polyclonal antibody against CCDC52. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CCDC52
Background The specific function of CCDC52 is not yet known.
Molecular Weight 96kDa
Gene ID 152185
NCBI Accession NP_653319, NM_144718
UniProt Q8N0Z3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCDC52 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "Spindle and Centriole Associated Protein 1 (SPICE1)", type "Antibodies"
Hosts (6)
Reactivities (5), (1), (1), (1), (1), (1)
Applications (7), (1)
Epitopes (2), (2), (1)
Beacon