Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503381

Dual Specificity Phosphatase 10 (DUSP10) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MKP5, MKP-5, 2610306G15Rik, AI158871, Mkp-5, Mkp5, DUSP10
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503381
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DUSP10 antibody: synthetic peptide directed towards the N terminal of human DUSP10
Sequence MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQN LRQYFEEAFE
Predicted Reactivity Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against DUSP10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DUSP10
Background Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the MAPK superfamily (MAPK/ERK, SAPK/JNK, p38), which is associat
Molecular Weight 16kDa
Gene ID 11221
NCBI Accession NP_653329, NM_144728
UniProt D3DTB4
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DUSP10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Teng, Huang, Meng: "Several dual specificity phosphatases coordinate to control the magnitude and duration of JNK activation in signaling response to oxidative stress." in: The Journal of biological chemistry, Vol. 282, Issue 39, pp. 28395-407, 2007 (PubMed).

Alternatives for antigen "Dual Specificity Phosphatase 10 (DUSP10)", type "Antibodies"
Hosts (33), (8), (1)
Reactivities (40), (21), (17), (13), (13), (12), (12)
Applications (30), (17), (10), (8), (3), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (2), (2), (1), (1), (1), (1)
Beacon