Did you know that you can buy products from over 140 different suppliers from us?

Dual Specificity Phosphatase 10 (DUSP10) (N-Term) antibody

Details for Product No. ABIN503381
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DUSP10, MKP-5, MKP5, 2610306G15Rik, AI158871, Mkp-5, Mkp5
Epitope
N-Term
(9), (8), (6), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(52), (20), (19), (13), (13), (12), (12)
Host
Rabbit
(45), (7), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(42), (26), (10), (9), (8), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503381
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DUSP10
Sequence MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQN LRQYFEEAFE
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against DUSP10. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DUSP10
Background Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the MAPK superfamily (MAPK/ERK, SAPK/JNK, p38), which is associat
Molecular Weight 16 kDa
Gene ID 11221
NCBI Accession NM_144728, NP_653329
UniProt D3DTB4
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 140 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Dual Specificity Phosphatase 10 (DUSP10) (N-Term) antibody WB Suggested Anti-DUSP10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate
Product cited in: Teng, Huang, Meng: "Several dual specificity phosphatases coordinate to control the magnitude and duration of JNK activation in signaling response to oxidative stress." in: The Journal of biological chemistry, Vol. 282, Issue 39, pp. 28395-407, 2007 (PubMed).

Validation Images
back to top