Did you know that you can buy products from over 140 different suppliers from us?

Tigger Transposable Element Derived 1 (TIGD1) (Middle Region) antibody

Details for Product No. ABIN503393
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EEYORE
Epitope
Middle Region
(9), (8), (7), (2), (2), (1), (1), (1)
Reactivity
Human
(32)
Host
Rabbit
(26), (5), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(30), (23), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503393
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TIGD1
Sequence SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDP PPAKRVRLTE
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against TIGD1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TIGD1
Background TIGD1 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this protein is not known.The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.
Molecular Weight 67 kDa
Gene ID 200765
NCBI Accession NM_145702, NP_663748
UniProt Q96MW7
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 591 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tigger Transposable Element Derived 1 (TIGD1) (Middle Region) antibody WB Suggested Anti-TIGD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: ACHN cell lysate
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503393
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top