Did you know that you can buy products from over 140 different suppliers from us?

RWD Domain Containing 4 (RWDD4) (Middle Region) antibody

Details for Product No. ABIN503430
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RWDD4A, FAM28A, fam28a, rwdd4a, BC016198, Gm1942, Rwdd4, Rwdd4a
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(5), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(6), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503430
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RWDD4A
Sequence SSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVK HLSKTGSKDD
Predicted Reactivity American bullfrog :100 %,   Mouse :100 %,   Rat :100 %,   Dog :100 %,   Chicken :100 %,   Bovine :100 %,   Human :100 %,   Western clawed frog :90 %,   African clawed frog :90 %,   Florida lancelet :70 %,  
Characteristics This is a rabbit polyclonal antibody against RWDD4A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RWDD4A
Background The specific function of this protein remains unknown.
Molecular Weight 21 kDa
Gene ID 201965
NCBI Accession NM_152682, NP_689895
UniProt Q6NW29
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 188 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RWD Domain Containing 4 (RWDD4) (Middle Region) antibody WB Suggested Anti-RWDD4A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: SH-SYSY cell lysate
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Validation Images
back to top