Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503460

RAB3A Interacting Protein (Rabin3) (RAB3IP) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RABIN3, B230311A06, Gtpat12, Rabin3, rabin3, gtpat12, MGC64583, MGC75737, MGC82752, zgc:110270, DKFZp469A0532, DKFZp469O1131
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503460
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RAB3IP antibody: synthetic peptide directed towards the N terminal of human RAB3IP
Sequence APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDG SDDIFGLSTD
Predicted Reactivity Human : 100%, Dog : 92%, Pig : 92%, Rabbit : 92%, Bovine : 85%, Horse : 84%, Rat : 84%
Characteristics This is a rabbit polyclonal antibody against RAB3IP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RAB3IP
Background The specific function of this protein remains unknown.
Molecular Weight 53kDa
Gene ID 117177
NCBI Accession NP_783322, NM_175623
UniProt Q96QF0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RAB3IP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hattula, Furuhjelm, Arffman et al.: "A Rab8-specific GDP/GTP exchange factor is involved in actin remodeling and polarized membrane transport." in: Molecular biology of the cell, Vol. 13, Issue 9, pp. 3268-80, 2002 (PubMed).

Alternatives for antigen "RAB3A Interacting Protein (Rabin3) (RAB3IP)", type "Antibodies"
Hosts (12), (1)
Reactivities (11), (7), (7), (1), (1), (1)
Applications (8), (7), (7), (1), (1)
Epitopes (3), (1)
Beacon