Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503512

Tyrosine-Protein Kinase JAK3 (JAK3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms JAKL, LJAK, JAK-3, L-JAK, JAK3_HUMAN, fae, wil, RATJAK3, JAK
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503512
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-JAK3 antibody: synthetic peptide directed towards the middle region of human JAK3
Sequence KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVW SFGVVLYELF
Predicted Reactivity Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Dog : 92%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against JAK3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name JAK3
Background JAK3 is a member of the Janus kinase (JAK) family of tyrosine kinases, which is involved in cytokine receptor-mediated intracellular signal transduction. JAK3 is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in JAK3 are associated with autosomal SCID (severe combined immunodeficiency disease).The protein encoded by this gene is a member of the Janus kinase (JAK) family of tyrosine kinases involved in cytokine receptor-mediated intracellular signal transduction. It is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in this gene are associated with autosomal SCID (severe combined immunodeficiency disease). Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.
Molecular Weight 125kDa
Gene ID 3718
NCBI Accession NP_000206, NM_000215
UniProt P52333
Research Area Signaling, Cytokines, Receptors, Kinases/Phosphatases
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-JAK3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cheng, Ross, Frost et al.: "Phosphorylation of human Jak3 at tyrosines 904 and 939 positively regulates its activity." in: Molecular and cellular biology, Vol. 28, Issue 7, pp. 2271-82, 2008 (PubMed).

Alternatives for antigen "Tyrosine-Protein Kinase JAK3 (JAK3)", type "Antibodies"
Hosts (57), (19)
Reactivities (73), (59), (47), (36), (36), (24)
Applications (37), (31), (30), (15), (10), (8), (6), (4), (4), (2), (1)
Conjugates (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3)
Epitopes (16), (12), (12), (6), (2), (2), (2)
Beacon