Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 6 Open Reading Frame 154 (C6orf154) (Middle Region) antibody

Details for Product No. ABIN503524
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C6orf154, LRRC73
Epitope
Middle Region
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
(15), (12), (12), (12), (12), (12)
Host
Rabbit
(17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (8), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503524
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C6orf154
Sequence NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSA QTLLDMVENY
Predicted Reactivity Horse : 100 %
Characteristics This is a rabbit polyclonal antibody against C6orf154. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C6orf154
Background The specific function of this protein remains unknown.
Molecular Weight 33 kDa
Gene ID 221424
NCBI Accession NM_001012974, NP_001012992
UniProt Q5JTD7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 316 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 6 Open Reading Frame 154 (C6orf154) (Middle Region) antibody WB Suggested Anti-C6orf154 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503524
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top