Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503524

Chromosome 6 Open Reading Frame 154 (C6orf154) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C6orf154, LRRC73
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503524
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C6orf154 antibody: synthetic peptide directed towards the middle region of human C6orf154
Sequence NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSA QTLLDMVENY
Predicted Reactivity Horse : 100%
Characteristics This is a rabbit polyclonal antibody against C6orf154. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C6orf154
Background The specific function of this protein remains unknown.
Molecular Weight 33kDa
Gene ID 221424
NCBI Accession NP_001012992, NM_001012974
UniProt Q5JTD7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C6orf154 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Alternatives for antigen "Chromosome 6 Open Reading Frame 154 (C6orf154)", type "Antibodies"
Hosts (18)
Reactivities (16), (12), (12), (12), (12), (12)
Applications (10), (9), (4), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (1)
Beacon