Did you know that you can buy products from over 140 different suppliers from us?

Flightless I Homolog (Drosophila) (FLII) (Middle Region) antibody

Details for Product No. ABIN503540
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FLI, FLIL, Fli1, Fliih, 3632430F08Rik, flightless, im:7141769, DKFZp459O043
Epitope
Middle Region
(2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Human, Chicken
(22), (14), (14), (11), (11), (11), (11), (1), (1)
Host
Rabbit
(23)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(9), (8), (7), (6), (4), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503540
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FLII
Sequence LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYD DDAEYMKHTR
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Guinea pig : 90 %, African clawed frog : 80 %, Chicken : 80 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against FLII. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FLII
Background FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.This gene encodes a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
Molecular Weight 145 kDa
Gene ID 2314
NCBI Accession NM_002018, NP_002009
UniProt Q13045
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1269 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Flightless I Homolog (Drosophila) (FLII) (Middle Region) antibody WB Suggested Anti-FLII Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysate
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503540
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top