Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503565

Inositol Polyphosphate-5-Phosphatase, 75kDa (INPP5B) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5PTase, 75kDa, AW260155, INPP5P
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN503565
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-INPP5B antibody: synthetic peptide directed towards the middle region of human INPP5B
Sequence IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSD VEIDLELFVN
Predicted Reactivity Guinea pig : 92%, Mouse : 92%, Pig : 92%, Horse : 91%, Rat : 91%, Dog : 84%, Rabbit : 76%
Characteristics This is a rabbit polyclonal antibody against INPP5B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name INPP5B
Background Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). INPP5B is the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus.Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). This gene encodes the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Molecular Weight 77kDa
Gene ID 3633
NCBI Accession NP_005531, NM_005540
UniProt P32019
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-INPP5B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Tothova, Kollipara, Huntly et al.: "FoxOs are critical mediators of hematopoietic stem cell resistance to physiologic oxidative stress." in: Cell, Vol. 128, Issue 2, pp. 325-39, 2007 (PubMed).

Background publications Dwyer: "Cell surface saccharides of Trypanosoma lewis i. II. Lectin-mediated agglutination and fine-structure cytochemical detection of lectin-binding sites." in: Journal of cell science, Vol. 22, Issue 1, pp. 1-19, 1976 (PubMed).

Alternatives for antigen "Inositol Polyphosphate-5-Phosphatase, 75kDa (INPP5B)", type "Antibodies"
Hosts (9), (2)
Reactivities (10), (2), (2)
Applications (11), (6), (3), (3), (2), (2)
Epitopes (3), (2), (2), (1), (1), (1)
Beacon