Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503582

Adaptor Protein, phosphotyrosine Interaction, PH Domain and Leucine Zipper Containing 1 (APPL1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms APPL, DIP13alpha, 2900057D21Rik, 7330406P05Rik, AI585782, AW209077, BB022931, C88264, DIP13, RGD1309388
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503582
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-APPL1 antibody: synthetic peptide directed towards the middle region of human APPL1
Sequence GQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFIVRF LGSMEVKSDD
Predicted Reactivity Guinea pig : 100%, Rat : 100%, Dog : 92%, Horse : 92%, Bovine : 85%, Chicken : 85%, Pig : 85%
Characteristics This is a rabbit polyclonal antibody against APPL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name APPL1
Background The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A
Molecular Weight 80kDa
Gene ID 26060
NCBI Accession NP_036228, NM_012096
UniProt Q9UKG1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-APPL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications McCrea, Paradise, Tomasini et al.: "All known patient mutations in the ASH-RhoGAP domains of OCRL affect targeting and APPL1 binding." in: Biochemical and biophysical research communications, Vol. 369, Issue 2, pp. 493-9, 2008 (PubMed).

Alternatives for antigen "Adaptor Protein, phosphotyrosine Interaction, PH Domain and Leucine Zipper Containing 1 (APPL1)", type "Antibodies"
Hosts (35), (6), (2)
Reactivities (39), (28), (17), (15), (13), (12)
Applications (33), (21), (10), (8), (4), (2), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (2), (1), (1), (1), (1), (1)
Beacon