Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503606

Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms P5CR2, 1810018M05Rik, P5cr2, p5c, p5cr, pro3, pycr, pig45, pp222, pycr2, arcl2b
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503606
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the C terminal of human PYCR2
Sequence LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLE SPTVSTLTPS
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against PYCR2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PYCR2
Background PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.
Molecular Weight 34kDa
Gene ID 29920
NCBI Accession NP_037460, NM_013328
UniProt Q96C36
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PYCR2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2)", type "Antibodies"
Hosts (16), (12)
Reactivities (26), (1), (1), (1), (1), (1), (1), (1)
Applications (28), (14), (8), (7), (5), (5), (1), (1)
Epitopes (2), (2), (2), (2), (1), (1), (1)
Beacon