Did you know that you can buy products from over 140 different suppliers from us?

RNA-Binding Protein NOB1 (NOB1) (C-Term) antibody

Details for Product No. ABIN503614
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MEE6.26, MEE6_26, Nob1p, fc27e05, si:ch73-167i17.3, wu:fc27e05, ART-4, MST158, NOB1P, PSMD8BP1, 1700021I09Rik, Psmd8bp1
Epitope
C-Term
(7), (7), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(25), (15), (15), (1), (1), (1), (1)
Host
Rabbit
(27)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (10), (8), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503614
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human NOB1
Sequence LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPD YIAGVSPFVE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against NOB1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NOB1
Background NOB1 may play a role in mRNA degradation.
Molecular Weight 47 kDa
Gene ID 28987
NCBI Accession NM_014062, NP_054781
UniProt Q9ULX3
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 412 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RNA-Binding Protein NOB1 (NOB1) (C-Term) antibody WB Suggested Anti-NOB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Validation Images
back to top