Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503614

RNA-Binding Protein NOB1 (NOB1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ART-4, MST158, NOB1P, PSMD8BP1, Nob1p, fc27e05, si:ch73-167i17.3, wu:fc27e05, 1700021I09Rik, Psmd8bp1, MEE6.26, MEE6_26
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503614
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NOB1 antibody: synthetic peptide directed towards the C terminal of human NOB1
Sequence LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPD YIAGVSPFVE
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against NOB1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NOB1
Background NOB1 may play a role in mRNA degradation.
Molecular Weight 47kDa
Gene ID 28987
NCBI Accession NP_054781, NM_014062
UniProt Q9ULX3
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NOB1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "RNA-Binding Protein NOB1 (NOB1)", type "Antibodies"
Hosts (23)
Reactivities (20), (15), (15), (2), (1), (1), (1)
Applications (14), (10), (7), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (1)
Beacon