Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503629

Origin Recognition Complex, Subunit 6 (ORC6) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
ORC6L, 6720420I10Rik, Orc6l, CG1584, DmORC 6, DmORC6, Dmel\\CG1584, ORC, ORC6, orc6, rDmORC, ARABIDOPSIS THALIANA ORIGIN RECOGNITION COMPLEX PROTEIN 6, ATORC6, ORIGIN RECOGNITION COMPLEX SUBUNIT 6, T2 ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503629
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ORC6L antibody: synthetic peptide directed towards the C terminal of human ORC6L
Sequence VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAA SAQKATAE
Predicted Reactivity Dog :100%,   Bovine :100%,   Mouse :100%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against ORC6L. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ORC6L
Background The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. ORC6L is a subunit of the ORC complex. It has been shown that this protein and and ORC1L are loosely associated with the core complex consisting of ORC2L, -3L, -4L and -5L. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis.The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. It has been shown that this protein and and ORC1L are loosely associated with the core complex consisting of ORC2L, -3L, -4L and -5L. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis.
Molecular Weight 28kDa
Gene ID 23594
NCBI Accession NP_055136, NM_014321
UniProt Q9Y5N6
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ORC6L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "Origin Recognition Complex, Subunit 6 (ORC6)", type "Antibodies"
Hosts (9), (7), (6), (5)
Reactivities (25), (2), (2)
Applications (25), (10), (5), (4), (4), (4), (3), (2), (2), (1)
Epitopes (5), (4)
Beacon