Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503633

Mitochondrial Carrier 2 (MTCH2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310034D24Rik, 4930539J07Rik, HSPC032, Hspc032, fi20c06, fj35g12, wu:fi20c06, wu:fj35g12, MIMP, SLC25A50
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503633
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MTCH2 antibody: synthetic peptide directed towards the N terminal of human MTCH2
Sequence ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGR NIFGRQVCQL
Predicted Reactivity Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, African clawed frog : 85%, Bovine : 85%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against MTCH2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MTCH2
Background MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.
Molecular Weight 33kDa
Gene ID 23788
NCBI Accession NP_055157, NM_014342
UniProt Q9Y6C9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MTCH2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Grinberg, Schwarz, Zaltsman et al.: "Mitochondrial carrier homolog 2 is a target of tBID in cells signaled to die by tumor necrosis factor alpha." in: Molecular and cellular biology, Vol. 25, Issue 11, pp. 4579-90, 2005 (PubMed).

Alternatives for antigen "Mitochondrial Carrier 2 (MTCH2)", type "Antibodies"
Hosts (30)
Reactivities (28), (22), (14), (12)
Applications (21), (15), (12), (9), (7)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (14), (2), (1)
Beacon