Did you know that you can buy products from over 140 different suppliers from us?

Rhabdoid Tumor Deletion Region Gene 1 (RTDR1) (Middle Region) antibody

Details for Product No. ABIN503641
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933431K05Rik, si:dkey-220o5.4
Epitope
Middle Region
(10), (7), (2), (1), (1), (1), (1), (1)
Reactivity
Cow (Bovine), Human
(15)
Host
Rabbit
(15), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (8), (7), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503641
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RTDR1
Sequence IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEK PQVAEALQRA
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against RTDR1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RTDR1
Background The specific function of the protein remains unknown.This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.
Molecular Weight 38 kDa
Gene ID 27156
NCBI Accession NM_014433, NP_055248
UniProt Q9UHP6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 348 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Rhabdoid Tumor Deletion Region Gene 1 (RTDR1) (Middle Region) antibody WB Suggested Anti-RTDR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
Background publications Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).

Validation Images
back to top