Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503641

Rhabdoid Tumor Deletion Region Gene 1 (RTDR1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933431K05Rik, si:dkey-220o5.4
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503641
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RTDR1 antibody: synthetic peptide directed towards the middle region of human RTDR1
Sequence IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEK PQVAEALQRA
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against RTDR1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RTDR1
Background The specific function of the protein remains unknown.This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.
Molecular Weight 38kDa
Gene ID 27156
NCBI Accession NP_055248, NM_014433
UniProt Q9UHP6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RTDR1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).

Alternatives for antigen "Rhabdoid Tumor Deletion Region Gene 1 (RTDR1)", type "Antibodies"
Hosts (9), (2)
Reactivities (9)
Applications (10), (3), (1), (1), (1)
Epitopes (5), (2), (1), (1), (1), (1), (1)
Beacon