Glutathione S-Transferase kappa 1 (GSTK1) (N-Term) antibody

Details for Product No. ABIN503686
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms GST, GST 13-13, GST13, GST13-13, GSTK1-1, hGSTK1, DsbA-L, AW260476, 0610025I19Rik, GSTkappa, gst13-13, GSTK1, gstk1, DKFZp459M1330
Epitope
N-Term
(5), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Dog (Canine), Human
(40), (25), (16), (12), (12), (12)
Host
Rabbit
(42), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(36), (12), (11), (10), (9), (5), (4), (4), (4), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN503686
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GSTK1
Sequence NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRH HLQIPIHFPK
Predicted Reactivity Human : 100 %, Dog : 80 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against GSTK1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GSTK1
Background GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.
Molecular Weight 25 kDa
Gene ID 373156
NCBI Accession NM_015917, NP_057001
UniProt Q9Y2Q3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 226 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glutathione S-Transferase kappa 1 (GSTK1) (N-Term) antibody WB Suggested Anti-GSTK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (42), (4)
Reactivities (40), (25), (16), (12), (12), (12)
Applications (36), (12), (11), (10), (9), (5), (4), (4), (4), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (2), (2), (1), (1), (1), (1), (1), (1)
back to top