Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503686

Glutathione S-Transferase kappa 1 (GSTK1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GST, GST 13-13, GST13, GST13-13, GSTK1-1, hGSTK1, DsbA-L, AW260476, 0610025I19Rik, GSTkappa, gst13-13, GSTK1, gstk1, DKFZp459M1330
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503686
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GSTK1 antibody: synthetic peptide directed towards the N terminal of human GSTK1
Sequence NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRH HLQIPIHFPK
Predicted Reactivity Human : 100%, Dog : 85%, Guinea pig : 84%
Characteristics This is a rabbit polyclonal antibody against GSTK1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GSTK1
Background GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.
Molecular Weight 25kDa
Gene ID 373156
NCBI Accession NP_057001, NM_015917
UniProt Q9Y2Q3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GSTK1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Glutathione S-Transferase kappa 1 (GSTK1)", type "Antibodies"
Hosts (37), (3)
Reactivities (36), (23), (14), (12), (12), (12)
Applications (31), (10), (9), (8), (6), (5), (4), (4), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (2), (2), (1), (1)
Beacon