Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503705

Epsin 2 (EPN2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
EHB21, Ibp2, AA536924, 9530051D10Rik, epsin-2, CG13853, CG13854, CG31170, CG31285, CG42250, Dmel\\CG42250, Dmel_CG31170, Dmel_CG31285, Epsin, LqfR, XII-10, epsin, epsin-like, epsin02, epsinR, l(3)0368 ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503705
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EPN2 antibody: synthetic peptide directed towards the middle region of human EPN2
Sequence SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEE ELQLQLALAM
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against EPN2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EPN2
Background This protein interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. It is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis.This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.
Molecular Weight 62kDa
Gene ID 22905
NCBI Accession NP_683723, NM_148921
UniProt Q52LD0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EPN2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "Epsin 2 (EPN2)", type "Antibodies"
Hosts (33), (14)
Reactivities (45), (26), (23), (12), (12), (12), (7)
Applications (38), (13), (12), (10), (10), (10), (6)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (1), (1), (1)
Beacon