Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503708

SUMO1/sentrin Specific Peptidase 5 (SENP5) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 6230429P13Rik, A730063F07Rik, AI851888, BB189556, SMT3IP3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503708
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SENP5 antibody: synthetic peptide directed towards the middle region of human SENP5
Sequence LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKP FINREITNYR
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against SENP5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SENP5
Background The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1, MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.
Molecular Weight 87kDa
Gene ID 205564
NCBI Accession NP_689912, NM_152699
UniProt Q96HI0
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SENP5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gong, Yeh: "Characterization of a family of nucleolar SUMO-specific proteases with preference for SUMO-2 or SUMO-3." in: The Journal of biological chemistry, Vol. 281, Issue 23, pp. 15869-77, 2006 (PubMed).

Alternatives for antigen "SUMO1/sentrin Specific Peptidase 5 (SENP5)", type "Antibodies"
Hosts (37), (2)
Reactivities (38), (23), (17), (12), (12), (12)
Applications (29), (16), (11), (10), (10), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (2), (2), (2), (2), (1), (1), (1)
Beacon