Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503727

Hexosaminidase D (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BC069960, si:ch211-173k16.6
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503727
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HEXDC antibody: synthetic peptide directed towards the middle region of human HEXDC
Sequence CQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLEN TEGSSTGRPA
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against HEXDC. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HEXDC
Background HEXDC has hexosaminidase activity.
Molecular Weight 63kDa
Gene ID 284004
NCBI Accession NP_775891, NM_173620
UniProt Q8WVB3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HEXDC antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives for antigen "Hexosaminidase D", type "Antibodies"
Hosts (14), (1)
Reactivities (14), (12), (12), (12)
Applications (10), (6), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon