Hexosaminidase D (Middle Region) antibody

Details for Product No. ABIN503727
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BC069960, si:ch211-173k16.6
Epitope
Middle Region
(1), (1)
Reactivity
Human
(14), (12), (12), (12)
Host
Rabbit
(14), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (9), (6), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN503727
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HEXDC
Sequence CQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLEN TEGSSTGRPA
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against HEXDC. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HEXDC
Background HEXDC has hexosaminidase activity.
Molecular Weight 63 kDa
Gene ID 284004
NCBI Accession NM_173620, NP_775891
UniProt Q8WVB3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 585 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Hexosaminidase D (Middle Region) antibody WB Suggested Anti-HEXDC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: SH-SYSY cell lysate
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Hosts (14), (1)
Reactivities (14), (12), (12), (12)
Applications (10), (9), (6), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top