Did you know that you can buy products from over 140 different suppliers from us?

Keratin 18 Pseudogene (FLJ40504) (N-Term) antibody

Details for Product No. ABIN503728
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Human
(1)
Host
Rabbit
(1), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503728
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FLJ40504
Sequence MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHEL HHLLHPLHQL
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against FLJ40504. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FLJ40504
Background The specific function of FFLJ40504 is not yet known.
Molecular Weight 29 kDa
Gene ID 284085
NCBI Accession NM_173624, NP_775895
UniProt Q8N7Q0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 259 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Keratin 18 Pseudogene (FLJ40504) (N-Term) antibody WB Suggested Anti-FLJ40504 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503728
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top