Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503728

Keratin 18 Pseudogene (FLJ40504) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503728
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FLJ40504 antibody: synthetic peptide directed towards the N terminal of human FLJ40504
Sequence MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHEL HHLLHPLHQL
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against FLJ40504. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FLJ40504
Background The specific function of FFLJ40504 is not yet known.
Molecular Weight 29kDa
Gene ID 284085
NCBI Accession NP_775895, NM_173624
UniProt Q8N7Q0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FLJ40504 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Keratin 18 Pseudogene (FLJ40504)", type "Antibodies"
Hosts (1)
Applications (1)
Beacon