Keratin 18 Pseudogene (FLJ40504) antibody

Antigen: Keratin 18 Pseudogene (FLJ40504)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN503728

Additional Information

Alternative name: FLJ40504

Gene ID: FLJ40504

UniProt: Q8N7Q0

Immunogen: The immunogen for anti-FLJ40504 antibody: synthetic peptide directed towards the N terminal of human FLJ40504

Sequence: MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHEL HHLLHPLHQL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-FLJ40504 antibody concentration is 1 mg/ml.

Description: The specific function of FFLJ40504 is not yet known.

Characteristics: Antigen Size: 259 amino acids

Molecular Weight: 29kDa

Application Details

Application Notes: WB Suggested Anti-FLJ40504 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-FLJ40504 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).