Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503732

Hypothetical Protein FLJ37543 (FLJ37543) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503732
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FLJ37543 antibody: synthetic peptide directed towards the middle region of human FLJ37543
Sequence PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMF SMLADCVLKS
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against FLJ37543. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FLJ37543
Background The specific function of the protein remains unknown.
Molecular Weight 15kDa
Gene ID 285668
NCBI Accession NP_775938, NM_173667
UniProt Q2M2E5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FLJ37543 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Hypothetical Protein FLJ37543 (FLJ37543)", type "Antibodies"
Hosts (5)
Reactivities (3)
Applications (5), (1)
Epitopes (2), (1)
Beacon