Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503733

Discoidin, CUB and LCCL Domain Containing 1 (DCBLD1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4631413K11Rik, dJ94G16.1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503733
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DCBLD1 antibody: synthetic peptide directed towards the N terminal of human DCBLD1
Sequence TITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGP YCGSMTVPKE
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rat : 100%, Dog : 92%, Rabbit : 92%, Guinea pig : 84%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against DCBLD1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DCBLD1
Background The specific function of the protein remains unknown.
Molecular Weight 59kDa
Gene ID 285761
NCBI Accession NP_775945, NM_173674
UniProt Q8N8Z6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DCBLD1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Alternatives for antigen "Discoidin, CUB and LCCL Domain Containing 1 (DCBLD1)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
Beacon