Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503791

HD Domain Containing 3 (HDDC3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110033O09Rik, C86475, MESH1, RGD1311839, zgc:110184
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503791
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HDDC3 antibody: synthetic peptide directed towards the middle region of human HDDC3
Sequence TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRD LNRCTPEVKI
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Pig : 100%, Zebrafish : 100%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against HDDC3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HDDC3
Background The specific function of the protein remains unknown.
Molecular Weight 16kDa
Gene ID 374659
NCBI Accession NP_940929, NM_198527
UniProt Q8N4P3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HDDC3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zody, Garber, Sharpe et al.: "Analysis of the DNA sequence and duplication history of human chromosome 15." in: Nature, Vol. 440, Issue 7084, pp. 671-5, 2006 (PubMed).

Alternatives for antigen "HD Domain Containing 3 (HDDC3)", type "Antibodies"
Hosts (14), (1)
Reactivities (14), (12), (11), (11), (11)
Applications (9), (6), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon