HD Domain Containing 3 (HDDC3) (Middle Region) antibody

Details for Product No. ABIN503791
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110033O09Rik, C86475, MESH1, RGD1311839, zgc:110184
Epitope
Middle Region
(1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Xenopus laevis, Human
(16), (13), (12), (11), (11)
Host
Rabbit
(15), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(9), (8), (4), (2)
Pubmed 1 reference available
Catalog no. ABIN503791
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HDDC3
Sequence TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRD LNRCTPEVKI
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Pig : 100 %, Zebrafish : 100 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against HDDC3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HDDC3
Background The specific function of the protein remains unknown.
Molecular Weight 16 kDa
Gene ID 374659
NCBI Accession NM_198527, NP_940929
UniProt Q8N4P3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 140 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-HD Domain Containing 3 (HDDC3) (Middle Region) antibody WB Suggested Anti-HDDC3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Zody, Garber, Sharpe et al.: "Analysis of the DNA sequence and duplication history of human chromosome 15...." in: Nature, Vol. 440, Issue 7084, pp. 671-5, 2006 (PubMed).

Hosts (15), (2)
Reactivities (16), (13), (12), (11), (11)
Applications (9), (8), (4), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top