Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503799

Adhesion Molecule with Ig-Like Domain 3 (AMIGO3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AMIGO-3, E430002N15Rik, ali3, mKIAA1851
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503799
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-AMIGO3 antibody: synthetic peptide directed towards the N terminal of human AMIGO3
Sequence MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCIC AADLLSCTGL
Predicted Reactivity Human : 100%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against AMIGO3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name AMIGO3
Background AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.
Molecular Weight 55kDa
Gene ID 386724
NCBI Accession NP_942015, NM_198722
UniProt Q86WK7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-AMIGO3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Adhesion Molecule with Ig-Like Domain 3 (AMIGO3)", type "Antibodies"
Hosts (25), (2), (1)
Reactivities (24), (16), (4), (2)
Applications (14), (13), (9), (6), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1), (1), (1)
Beacon