Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503819

Zinc Finger, DHHC-Type Containing 24 (ZDHHC24) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5730496N17Rik, Leng4, zgc:91907, wu:fe02b01
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503819
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZDHHC24 antibody: synthetic peptide directed towards the N terminal of human ZDHHC24
Sequence YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLR SDPSIRGVML
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Bovine : 92%
Characteristics This is a rabbit polyclonal antibody against ZDHHC24. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZDHHC24
Background The specific function of the protein remains unknown.
Molecular Weight 30kDa
Gene ID 254359
NCBI Accession NP_997223, NM_207340
UniProt Q6UX98
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZDHHC24 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Zinc Finger, DHHC-Type Containing 24 (ZDHHC24)", type "Antibodies"
Hosts (8)
Reactivities (6), (1), (1), (1)
Applications (8), (3), (1)
Epitopes (3), (2), (1), (1), (1), (1)
Beacon