Zinc Finger, DHHC-Type Containing 24 (ZDHHC24) (N-Term) antibody

Details for Product No. ABIN503819
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5730496N17Rik, Leng4, zgc:91907, wu:fe02b01
Epitope
N-Term
(1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(4), (1), (1), (1)
Host
Rabbit
(6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (1)
Pubmed 1 reference available
Catalog no. ABIN503819
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZDHHC24
Sequence YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLR SDPSIRGVML
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Bovine : 90 %
Characteristics This is a rabbit polyclonal antibody against ZDHHC24. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZDHHC24
Background The specific function of the protein remains unknown.
Molecular Weight 30 kDa
Gene ID 254359
NCBI Accession NM_207340, NP_997223
UniProt Q6UX98
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 284 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger, DHHC-Type Containing 24 (ZDHHC24) (N-Term) antibody WB Suggested Anti-ZDHHC24 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment...." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Hosts (6)
Reactivities (4), (1), (1), (1)
Applications (6), (1)
Epitopes (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top