Zinc Finger, DHHC-Type Containing 24 (ZDHHC24) antibody

Antigen: Zinc Finger, DHHC-Type Containing 24 (ZDHHC24)

Synonyms: zgc:91907, wu:fe02b01

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN503819

Additional Information

Alternative name: ZDHHC24

Gene ID: ZDHHC24

UniProt: Q6UX98

Immunogen: The immunogen for anti-ZDHHC24 antibody: synthetic peptide directed towards the N terminal of human ZDHHC24

Sequence: YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLR SDPSIRGVML

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZDHHC24 antibody concentration is 1 mg/ml.

Description: The specific function of the protein remains unknown.

Characteristics: Antigen Size: 284 amino acids

Molecular Weight: 30kDa

Application Details

Application Notes: WB Suggested Anti-ZDHHC24 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZDHHC24 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver

Publications

Product: Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).