FLJ35767 (Middle Region) antibody

Details for Product No. ABIN503825
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
Middle Region
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Catalog no. ABIN503825
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FLJ35767
Sequence PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLP WRFEELLTCS
Predicted Reactivity Human :100 %,   Mouse :80 %,   Rat :80 %,   Bovine :70 %,  
Characteristics This is a rabbit polyclonal antibody against FLJ35767. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background The specific function of the protein remains unknown.
Molecular Weight 18 kDa
Gene ID 400629
NCBI Accession NM_207459, NP_997342
UniProt Q8NA77
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 164 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-FLJ35767 (Middle Region) antibody WB Suggested Anti-FLJ35767 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Placenta
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (1)
Applications (1)
back to top