Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503827

Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 6430595O10Rik, AI447224, Gm1184, Mem1, FAM15B, zgc:112014
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503827
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMED8 antibody: synthetic peptide directed towards the middle region of human TMED8
Sequence EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQA GSHDYPGEGI
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against TMED8. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMED8
Background The specific function of the protein remains unknown.
Molecular Weight 36kDa
Gene ID 283578
NCBI Accession NP_998766, NM_213601
UniProt Q6PL24
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMED8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Petroziello, Yamane, Westendorf et al.: "Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer." in: Oncogene, Vol. 23, Issue 46, pp. 7734-45, 2004 (PubMed).

Alternatives for antigen "Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8)", type "Antibodies"
Hosts (9)
Reactivities (7), (1), (1), (1), (1), (1), (1)
Applications (9), (1), (1)
Epitopes (3), (2), (2), (2), (1)
Beacon