Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503879

S100P Binding Protein (S100PBP) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms S100PBPR, AI851343, S100pbpr, 4930429A08Rik, RGD1564943, s100pbpr
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503879
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-S100PBP antibody: synthetic peptide directed towards the middle region of human S100PBP
Sequence ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIA HIEDPEDTNQ
Predicted Reactivity Human : 100%, Horse : 85%, Dog : 84%, Mouse : 84%, Rabbit : 76%
Characteristics This is a rabbit polyclonal antibody against S100PBP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name S100PBP
Background The specific function of this protein remains unknown.
Molecular Weight 37kDa
Gene ID 64766
NCBI Accession NP_001017406, NM_001017406
UniProt A8MTZ6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-S100PBP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deng, Shi, Wilkerson et al.: "Usefulness of S100P in diagnosis of adenocarcinoma of pancreas on fine-needle aspiration biopsy specimens." in: American journal of clinical pathology, Vol. 129, Issue 1, pp. 81-8, 2007 (PubMed).

Alternatives for antigen "S100P Binding Protein (S100PBP)", type "Antibodies"
Hosts (14), (1)
Reactivities (14), (12), (12)
Applications (10), (6), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon