S100P Binding Protein (S100PBP) (Middle Region) antibody

Details for Product No. ABIN503879
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms S100PBPR, AI851343, S100pbpr, 4930429A08Rik, RGD1564943, s100pbpr
Epitope
Middle Region
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(15), (12), (12)
Host
Rabbit
(14), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7), (3), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN503879
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human S100PBP
Sequence ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIA HIEDPEDTNQ
Predicted Reactivity Human : 100 %, Horse : 80 %, Dog : 80 %, Mouse : 80 %, Rabbit : 70 %
Characteristics This is a rabbit polyclonal antibody against S100PBP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name S100PBP
Background The specific function of this protein remains unknown.
Molecular Weight 37 kDa
Gene ID 64766
NCBI Accession NM_001017406, NP_001017406
UniProt A8MTZ6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 341 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-S100P Binding Protein (S100PBP) (Middle Region) antibody WB Suggested Anti-S100PBP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Deng, Shi, Wilkerson et al.: "Usefulness of S100P in diagnosis of adenocarcinoma of pancreas on fine-needle aspiration biopsy specimens." in: American journal of clinical pathology, Vol. 129, Issue 1, pp. 81-8, 2007 (PubMed).

Hosts (14), (2)
Reactivities (15), (12), (12)
Applications (10), (7), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
back to top