Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503904

Family with Sequence Similarity 63, Member A (FAM63A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1810005H09Rik, 4930504E06Rik, AA562754, AA960384, AW561904, cI-40, mKIAA1390, ni, RP11-316M1.5
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503904
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM63A antibody: synthetic peptide directed towards the middle region of human FAM63A
Sequence LQQEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQ RPKHESDCIL
Predicted Reactivity Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Horse : 92%, Bovine : 84%, Dog : 84%
Characteristics This is a rabbit polyclonal antibody against FAM63A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM63A
Background The specific function of this protein remains unknown.
Molecular Weight 36kDa
Gene ID 55793
NCBI Accession NP_001035307, NM_001040217
UniProt Q8N5J2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM63A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 63, Member A (FAM63A)", type "Antibodies"
Hosts (14)
Reactivities (13), (12), (12), (12), (12)
Applications (10), (5), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon