Did you know that you can buy products from over 140 different suppliers from us?

Family with Sequence Similarity 63, Member A (FAM63A) (Middle Region) antibody

Details for Product No. ABIN503904
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RP11-316M1.5, 1810005H09Rik, 4930504E06Rik, AA562754, AA960384, AW561904, cI-40, mKIAA1390, ni, si:ch211-210h11.5
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(13), (12), (12), (12), (12)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (5), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503904
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FAM63A
Sequence LQQEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQ RPKHESDCIL
Predicted Reactivity Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Horse : 90 %, Bovine : 80 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against FAM63A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FAM63A
Background The specific function of this protein remains unknown.
Molecular Weight 36 kDa
Gene ID 55793
NCBI Accession NM_001040217, NP_001035307
UniProt Q8N5J2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 327 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family with Sequence Similarity 63, Member A (FAM63A) (Middle Region) antibody WB Suggested Anti-FAM63A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Validation Images
back to top