PSMA4,   (N-Term) antibody

Details for Product No. ABIN503918
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(3), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
(37), (19), (19), (12), (3), (3)
Host
Rabbit
(22), (13), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(28), (13), (10), (8), (6), (4), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN503918
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PSMA4
Sequence PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGF QLYQSDPSGN
Predicted Reactivity Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %, African clawed frog : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %
Characteristics This is a rabbit polyclonal antibody against PSMA4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PSMA4
Background The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta
Molecular Weight 21 kDa
Gene ID 5685
NCBI Accession NM_001102668, NP_001096138
UniProt Q567Q5
Research Area Proteolysis / Ubiquitin, Proteasome
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 190 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-PSMA4,   (N-Term) antibody WB Suggested Anti-PSMA4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart
Background publications Amos, Wu, Broderick et al.: "Genome-wide association scan of tag SNPs identifies a susceptibility locus for lung cancer at 15q25.1." in: Nature genetics, Vol. 40, Issue 5, pp. 616-22, 2008 (PubMed).

Hosts (22), (13), (3)
Reactivities (37), (19), (19), (12), (3), (3)
Applications (28), (13), (10), (8), (6), (4), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top