Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503918

PSMA4,   (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503918
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PSMA4 antibody: synthetic peptide directed towards the N terminal of human PSMA4
Sequence PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGF QLYQSDPSGN
Predicted Reactivity Rabbit : 100%, Rat : 100%, Zebrafish : 100%, African clawed frog : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%
Characteristics This is a rabbit polyclonal antibody against PSMA4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PSMA4
Background The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta
Molecular Weight 21kDa
Gene ID 5685
NCBI Accession NP_001096138, NM_001102668
UniProt Q567Q5
Research Area Proteolysis / Ubiquitin, Proteasome
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PSMA4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Amos, Wu, Broderick et al.: "Genome-wide association scan of tag SNPs identifies a susceptibility locus for lung cancer at 15q25.1." in: Nature genetics, Vol. 40, Issue 5, pp. 616-22, 2008 (PubMed).

Alternatives for antigen "PSMA4,  ", type "Antibodies"
Hosts (22), (13), (3)
Reactivities (37), (18), (18), (12), (3), (3)
Applications (27), (14), (10), (7), (6), (4), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3), (2)
Beacon