Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Proteasome (Prosome, Macropain) Subunit, alpha Type, 4 (PSMA4) antibody

Antigen

Proteasome (Prosome, Macropain) Subunit, alpha Type, 4 (PSMA4)

Synonyms HC9, PSC9, HsT17706, MGC12467, MGC24813, MGC111191, C9
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503918
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name PSMA4
Gene ID PSMA4
UniProt Q567Q5
Immunogen The immunogen for anti-PSMA4 antibody: synthetic peptide directed towards the N terminal of human PSMA4
Sequence PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGF QLYQSDPSGN
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PSMA4 antibody concentration is 1 mg/ml.
Description The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta
Characteristics Antigen Size: 190 amino acids
Molecular Weight 21kDa

Application Details

Application Notes WB Suggested Anti-PSMA4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Proteolysis / Ubiquitin, Proteasome
Restrictions For Research Use only

Publications

Product Amos, Wu, Broderick et al.: "Genome-wide association scan of tag SNPs identifies a susceptibility locus for lung cancer at 15q25.1." in: Nature genetics, Vol. 40, Issue 5, pp. 616-22, 2008 (PubMed).

Alternatives

Alternatives for antigen "Proteasome (Prosome, Macropain) Subunit, alpha Type, 4 (PSMA4)", type "Antibodies"
Hosts Rabbit (13), Mouse (5), Goat (3)
Reactivities Human (19), Mouse (Murine) (9), Rat (Rattus) (9), Dog (Canine) (3), Monkey (3)
Applications Western Blotting (WB) (20), ELISA (11), Immunohistochemistry (IHC) (8), Flow Cytometry (FACS) (1), Immunofluorescence (IF) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Epitopes N-Term (2), C-Term (1), Internal Region (1)