Did you know that you can buy products from over 140 different suppliers from us?

Melanoma Antigen Family B, 3 (MAGEB3) (N-Term) antibody

Details for Product No. ABIN503931
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CT3.5, Smage3, Mage-b3, Mage-ps1, Mage-rs3, RGD1562343, Mageb3, EG436212, MAGEB3
Epitope
N-Term
(9), (3)
Reactivity
Human
(27)
Host
Rabbit
(29)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (9), (7), (6), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503931
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MAGEB3
Sequence KKKVSFSSPLILGATIQKKSAGRSRSALKKPQRALSTTTS VDVSYKKSYK
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against MAGEB3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MAGEB3
Background This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognized on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos
Molecular Weight 39 kDa
Gene ID 4114
NCBI Accession NM_002365, NP_002356
UniProt O15480
Research Area Cancer
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 346 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Melanoma Antigen Family B, 3 (MAGEB3) (N-Term) antibody WB Suggested Anti-MAGEB3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome...." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503931
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top