Did you know that you can buy products from over 140 different suppliers from us?

Matrix Metallopeptidase 13 (Collagenase 3) (MMP13) (Middle Region) antibody

Details for Product No. ABIN503937
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms cb1034, mmp13, MMP13, xCol, xcl3, MMP-13, MGC108008, Clg, Mmp1, CLG3, MANDP1, gene A
Epitope
Middle Region
(13), (7), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(109), (40), (30), (8), (3), (3), (2), (1), (1), (1), (1)
Host
Rabbit
(100), (31), (5), (3), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(11), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(112), (56), (50), (44), (30), (26), (14), (13), (10), (3), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503937
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MMP13
Sequence HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSL DAITSLRGET
Predicted Reactivity Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Dog : 90 %, Mouse : 90 %, Rat : 90 %, Sheep : 90 %, Chicken : 90 %, Bovine : 80 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against MMP13. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MMP13
Background Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art
Molecular Weight 42 kDa
Gene ID 4322
NCBI Accession NM_002427, NP_002418
UniProt P45452
Research Area Cancer, Proteolysis / Ubiquitin, Metalloprotease, Angiogenesis, Extracellular Matrix, Matrix Metalloproteinases
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 471 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Matrix Metallopeptidase 13 (Collagenase 3) (MMP13) (Middle Region) antibody WB Suggested Anti-MMP13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta
anti-Matrix Metallopeptidase 13 (Collagenase 3) (MMP13) (Middle Region) antibody (2) Sample Type: Equine Cartilage Explants
Primary Dilution: 1:1000
Secondary Antibody: Bio-Rad 170-5046
Secondary Dilution: 1:100,000
Image Submitted By: Adam Williams
University of Nottingham
anti-Matrix Metallopeptidase 13 (Collagenase 3) (MMP13) (Middle Region) antibody (3) Sample Type: 1. Normal HUman Cartilage (50ug)
2. Human Osteoarthritis cartilage (50ug)
3. Human Osteoarthritis chondrocytes (50ug)
4. Human Osteoarthritis chondrocytes +IL-1 (50ug)
Primary Dilution: 1:2000
Secondary Antibody: HRP conjugated anti-rabbit
Secondary Dilution: 1:5000
Image Submitted By: Mukundan Attur
NYU Hospital for Joint Disease
Background publications Borghese, Chiche, Vernerey et al.: "Genetic polymorphisms of matrix metalloproteinase 12 and 13 genes are implicated in endometriosis progression." in: Human reproduction (Oxford, England), Vol. 23, Issue 5, pp. 1207-13, 2008 (PubMed).

Validation Images
back to top