Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503937

Matrix Metallopeptidase 13 (Collagenase 3) (MMP13) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CLG3, MANDP1, xCol, xcl3, MMP-13, gene A, Clg, Mmp1, cb1034, mmp13, MMP13, MGC108008
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503937
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MMP13 antibody: synthetic peptide directed towards the middle region of human MMP13
Sequence HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSL DAITSLRGET
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Dog : 92%, Mouse : 92%, Rat : 92%, Sheep : 92%, Chicken : 91%, Bovine : 85%, African clawed frog : 83%
Characteristics This is a rabbit polyclonal antibody against MMP13. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MMP13
Background Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art
Molecular Weight 42kDa
Gene ID 4322
NCBI Accession NP_002418, NM_002427
UniProt P45452
Research Area Cancer, Proteolysis / Ubiquitin, Metalloprotease, Angiogenesis, Extracellular Matrix, Matrix Metalloproteinases
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MMP13 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Borghese, Chiche, Vernerey et al.: "Genetic polymorphisms of matrix metalloproteinase 12 and 13 genes are implicated in endometriosis progression." in: Human reproduction (Oxford, England), Vol. 23, Issue 5, pp. 1207-13, 2008 (PubMed).

Alternatives for antigen "Matrix Metallopeptidase 13 (Collagenase 3) (MMP13)", type "Antibodies"
Hosts (87), (34), (4), (4), (1)
Reactivities (103), (40), (30), (8), (3), (3), (1), (1), (1), (1)
Applications (96), (55), (39), (33), (30), (20), (10), (8), (6), (3), (3), (2), (2), (2), (1)
Conjugates (8), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (4), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon