Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503969

PRKY (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRKXP3, PRKYP
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503969
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PRKY antibody: synthetic peptide directed towards the N terminal of human PRKY
Sequence MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPE APAYRLQDCD
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against PRKY. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromsoome. The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense
Molecular Weight 32kDa
Gene ID 5616
NCBI Accession NP_002751, NM_002760
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PRKY antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Skaletsky, Kuroda-Kawaguchi, Minx et al.: "The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes." in: Nature, Vol. 423, Issue 6942, pp. 825-37, 2003 (PubMed).

Alternatives for antigen "PRKY", type "Antibodies"
Hosts (15), (2)
Reactivities (17)
Applications (16), (10), (2), (1), (1), (1)
Epitopes (4), (2), (1), (1)
Beacon