Proteasome (Prosome, Macropain) Subunit, beta Type, 5 (PSMB5) antibody

Antigen: Proteasome (Prosome, Macropain) Subunit, beta Type, 5 (PSMB5)

Synonyms: X, MB1, LMPX, MGC104214, MGC118075, x, fb59c07, zgc:86820, wu:fb59c07, etID309919.2, si:zc14a17.13, PSMB5, MGC134464, DKFZp459C139

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Dog (Canine), Xenopus laevis, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN503976

Additional Information

Alternative name: PSMB5

Gene ID: PSMB5

UniProt: P28074

Immunogen: The immunogen for anti-PSMB5 antibody: synthetic peptide directed towards the middle region of human PSMB5

Sequence: IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADC SFWERLLARQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PSMB5 antibody concentration is 1 mg/ml.

Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB5 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome. This catalytic subunit is not present in the immunoproteasome and is replaced by catalytic subunit 3i (proteasome beta 8 subunit).The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome. This catalytic subunit is not present in the immunoproteasome and is replaced by catalytic subunit 3i (proteasome beta 8 subunit). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 263 amino acids

Molecular Weight: 28kDa

Application Details

Application Notes: WB Suggested Anti-PSMB5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Proteolysis / Ubiquitin, Proteasome

Restrictions: For Research Use only

Images

WB Suggested Anti-PSMB5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).