Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503988

Ran GTPase Activating Protein 1 (RANGAP1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Fug1, RANGAP, SD, RanGAP1, fug1, rangap1b, rna1p, C79654, mKIAA1835, rangap1, rangap1a, ATRANGAP1, RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503988
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RANGAP1 antibody: synthetic peptide directed towards the N terminal of human RANGAP1
Sequence MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKD VIKEIEDFDS
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against RANGAP1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RANGAP1
Background RanGAP1, is a homodimeric 65-kD polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state. The RANGA
Molecular Weight 63kDa
Gene ID 5905
NCBI Accession NP_002874, NM_002883
UniProt P46060
Research Area Nuclear Transport, Cell Cycle
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RANGAP1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Ran GTPase Activating Protein 1 (RANGAP1)", type "Antibodies"
Hosts (34), (9), (5)
Reactivities (42), (24), (19), (15), (14), (11), (6)
Applications (36), (15), (14), (12), (9), (9), (4), (3), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (2), (2), (1), (1), (1), (1)
Beacon