Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503997

Mitogen-Activated Protein Kinase 12 (MAPK12) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
ERK3, ERK6, SAPK3, PRKM12, SAPK-3, P38GAMMA, AW123708, Erk6, P38gamma, Prkm12, Sapk3, erk6, etID309866.18, mapk12, sapk3, wu:fa05c12, zgc:101695, MAPK12, MGC160082, si:dkey-14d8.5, ATMPK12, T3F17.28,  ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503997
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MAPK12 antibody: synthetic peptide directed towards the N terminal of human MAPK12
Sequence SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRE LRLLKHMRHE
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Dog : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against MAPK12. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MAPK12
Background Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal t
Molecular Weight 42kDa
Gene ID 6300
NCBI Accession NP_002960, NM_002969
UniProt P53778
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MAPK12 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Qi, Pohl, Loesch et al.: "p38alpha antagonizes p38gamma activity through c-Jun-dependent ubiquitin-proteasome pathways in regulating Ras transformation and stress response." in: The Journal of biological chemistry, Vol. 282, Issue 43, pp. 31398-408, 2007 (PubMed).

Alternatives for antigen "Mitogen-Activated Protein Kinase 12 (MAPK12)", type "Antibodies"
Hosts (42), (12)
Reactivities (53), (32), (27), (12), (12), (12), (12), (12)
Applications (33), (23), (20), (12), (7), (5), (3), (2), (1), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (12), (12), (5), (5), (5), (1), (1), (1), (1)
Beacon