Did you know that you can buy products from over 140 different suppliers from us?

RAB5A, Member RAS Oncogene Family (RAB5A) (Middle Region) antibody

Details for Product No. ABIN504006
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DDBDRAFT_0168594, DDBDRAFT_0229401, DDB_0168594, DDB_0229401, rab5, RAB5A, RAB5, 2410015H04Rik, AI663973, AU021172, nnyRab5a
Epitope
Middle Region
(15), (11), (9), (6), (5), (3), (3), (3), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(104), (55), (43), (22), (16), (14), (9), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Host
Rabbit
(85), (24), (4), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(100), (28), (25), (21), (11), (10), (9), (8), (7), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504006
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RAB5A
Sequence SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQ EAQSYADDNS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Sheep : 100 %, African clawed frog : 90 %, Chicken : 90 %, Guinea pig : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against RAB5A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RAB5A
Background RAB5A is required for the fusion of plasma membranes and early endosomes.
Molecular Weight 24 kDa
Gene ID 5868
NCBI Accession NM_004162, NP_004153
UniProt P20339
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 215 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RAB5A, Member RAS Oncogene Family (RAB5A) (Middle Region) antibody WB Suggested Anti-RAB5A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
anti-RAB5A, Member RAS Oncogene Family (RAB5A) (Middle Region) antibody (2) Lanes: Lane 1: Mouse C2 cell lysate
Lane 2: GFP-Rab5 transfected cos cellsLane 3: GFP-Rab31 transfected cos cells
Primary Antibody Dilution: 1:500
Secondary Antibody: Goat anti rabbit-HRP
Secondary Antibody Dilution: 1:0000
Gene Name: RAB5A

Submitted by: Ruth Herbst, Medical University Vienna
Background publications Coyne, Shen, Turner et al.: "Coxsackievirus entry across epithelial tight junctions requires occludin and the small GTPases Rab34 and Rab5." in: Cell host & microbe, Vol. 2, Issue 3, pp. 181-92, 2007 (PubMed).

Validation Images
back to top