Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504007

RAB5A, Member RAS Oncogene Family (RAB5A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RAB5, 2410015H04Rik, AI663973, AU021172, nnyRab5a, DDBDRAFT_0168594, DDBDRAFT_0229401, DDB_0168594, DDB_0229401, rab5, RAB5A
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN504007
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A
Sequence KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEP TQPTRNQCCS
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Chicken : 85%, Pig : 78%, Sheep : 78%
Characteristics This is a rabbit polyclonal antibody against RAB5A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RAB5A
Background RAB5A is required for the fusion of plasma membranes and early endosomes.
Molecular Weight 24kDa
Gene ID 5868
NCBI Accession NP_004153, NM_004162
UniProt P20339
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RAB5A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Coyne, Shen, Turner et al.: "Coxsackievirus entry across epithelial tight junctions requires occludin and the small GTPases Rab34 and Rab5." in: Cell host & microbe, Vol. 2, Issue 3, pp. 181-92, 2007 (PubMed).

Alternatives for antigen "RAB5A, Member RAS Oncogene Family (RAB5A)", type "Antibodies"
Hosts (59), (20), (4), (4)
Reactivities (78), (52), (40), (26), (18), (16), (12), (4), (4), (4), (4), (4), (4), (4), (4), (4), (2), (2)
Applications (75), (27), (13), (10), (10), (9), (6), (3), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (9), (6), (3), (3), (3), (2), (2), (2), (1)
Beacon