Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504047

Phytanoyl-CoA 2-Hydroxylase (PHYH) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RD, LN1, PAHX, LNAP1, PHYH1, AI256161, AI265699, Lnap1, zgc:110203
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504047
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PHYH antibody: synthetic peptide directed towards the middle region of human PHYH
Sequence EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYI DVKGTSQENI
Predicted Reactivity Human : 100%, Mouse : 92%, African clawed frog : 85%, Pig : 85%
Characteristics This is a rabbit polyclonal antibody against PHYH. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PHYH
Background This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Mutations in this gene have b
Molecular Weight 39kDa
Gene ID 5264
NCBI Accession NP_006205, NM_006214
UniProt O14832
Research Area Cancer, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PHYH antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Phytanoyl-CoA 2-Hydroxylase (PHYH)", type "Antibodies"
Hosts (24), (16)
Reactivities (37), (24), (24), (4), (4)
Applications (34), (18), (7), (6), (4), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (21), (4), (2), (1)
Beacon