Phytanoyl-CoA 2-Hydroxylase (PHYH) (Middle Region) antibody

Details for Product No. ABIN504047
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RD, LN1, PAHX, LNAP1, PHYH1, AI256161, AI265699, Lnap1, zgc:110203
Epitope
Middle Region
(21), (4), (2), (1), (1), (1)
Reactivity
Human
(37), (20), (20), (2)
Host
Rabbit
(25), (15)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(38), (18), (9), (8), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN504047
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PHYH
Sequence EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYI DVKGTSQENI
Predicted Reactivity Human : 100 %, Mouse : 90 %, African clawed frog : 80 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against PHYH. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PHYH
Background This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Mutations in this gene have b
Molecular Weight 39 kDa
Gene ID 5264
NCBI Accession NM_006214, NP_006205
UniProt O14832
Research Area Cancer, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 338 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Phytanoyl-CoA 2-Hydroxylase (PHYH) (Middle Region) antibody WB Suggested Anti-PHYH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (25), (15)
Reactivities (37), (20), (20), (2)
Applications (38), (18), (9), (8), (3), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (21), (4), (2), (1), (1), (1)
back to top