CutC Copper Transporter Homolog (E. Coli) (CUTC) (Middle Region) antibody

Details for Product No. ABIN504087
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RP11-483F11.3, 2310039I18Rik, AI326282, CGI-32, zgc:103406
Epitope
Middle Region
(2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(22), (15), (14)
Host
Rabbit
(23), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (10), (6), (3), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN504087
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CUTC
Sequence LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGA TEFHCSARST
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Chicken : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against CUTC. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CUTC
Background Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 [PubMed 7635807], Li et al., 2005 [PubMed 16182249]).
Molecular Weight 29 kDa
Gene ID 51076
NCBI Accession NM_015960, NP_057044
UniProt Q9NTM9
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 273 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-CutC Copper Transporter Homolog (E. Coli) (CUTC) (Middle Region) antibody WB Suggested Anti-CUTC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Hosts (23), (1)
Reactivities (22), (15), (14)
Applications (14), (10), (6), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top